PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009619248.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 332aa    MW: 37664.2 Da    PI: 7.2589
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009619248.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.5e-54121411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_009619248.1  12 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKEicRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAI 105
                     69****************************.9***************954555442556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  XP_009619248.1 106 YLSNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 141
                     **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-604161IPR003441NAC domain
PROSITE profilePS5100558.34212161IPR003441NAC domain
PfamPF023653.5E-2813141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MMSGAGNGQL SVPPGFRFHP TDEELLYYYL RKKVSYEAID LDVIREVDLN KLEPWDLKEI  60
CRIGSGPQNE WYFFSHKDKK YPTGTRTNRA TAAGFWKATG RDKAIYLSNS KRIGMRKTLV  120
FYTGRAPHGQ KTDWIMHEYR LDDNTAEVEE DGWVVCRVFK KKNYTRGFQH ELGGDDHEQQ  180
LHFADHMKSG SSDPKQNMQQ PHHQACYDYA SNFDGSMHLP QLLSPDLLSV TPCPQLPLSS  240
NMNLNECSHQ NLLRLTSAAG AAGCSNSTFN IIPQHDKFSG DWSFLDKLLA SNQGALQSQA  300
AIGDNLVNPT GTQKYPVFHH HGFDPDLFKF SK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-50916314167NAC domain-containing protein 19
4dul_A3e-50916314167NAC domain-containing protein 19
1ut7_B3e-50916314167NO APICAL MERISTEM PROTEIN
1ut7_A3e-50916314167NO APICAL MERISTEM PROTEIN
1ut4_B3e-50916314167NO APICAL MERISTEM PROTEIN
1ut4_A3e-50916314167NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754511e-82HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619248.10.0PREDICTED: NAC domain-containing protein 76 isoform X2
SwissprotQ9MA171e-117SMB_ARATH; Protein SOMBRERO
TrEMBLM1AKX20.0M1AKX2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000250260.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-107NAC family protein